MyMojoHealth MyMojoMacros MyMojoMarket
Keto-Mojo
Help My Store Account Shop
  • Search

    More results...

    Article
    Recipes
    Video
    LowCarbUSA Speaker
    Events
  • → START HERE!
  • Keto Basics
    • 7 Steps to Keto Success
    • Keto Guides
    • Health Benefits
    • Fasting
    • Ketosis for Beginners
    • Macros & Calorie Counting
    • Side Effects
  • Testing Basics
    • How-To Videos
    • Ketone/Glucose Testing
    • MyMojoHealth
    • GKI Calculator
    • Infographics
    • Accuracy
    • Testimonials
  • Food
    • Keto & Low-Carb Recipes
    • Nutrition
    • View/Create Your Meal Plans
    • Macros Calculator
    • My Shopping List
    • Join Our Recipe Newsletter!
  • Health
    • Weight Loss
    • Fitness
    • Diabetes
    • Epilepsy
    • Neurological
    • Cancer
    • Heart Health
    • Women’s Health
    • Men’s Health
  • Videos
    • Mojo Academy
    • LowCarbUSA Speaker Series
    • How-To Videos (US)
    • How-To Videos (Europe)
    • MyMojoHealth for Users
    • MyMojoHealth for Practitioners
  • Blog
    • Blog Articles
    • In the News
    • Product and Book Reviews
    • Success Stories
  • Practitioners
    • Platform Solutions
    • Practitioner Tools
    • Patient Resources
    • The Bigger Picture
    • Testimonials
    • Login
  • Research
Find Us on Linkedin Find Us on Facebook Find Us on Instagram Find Us on YouTube Find Us on Pinterest Find Us on Twitter Email Us
  • Resources
    • MyMojoHealth
    • Request a MMH Demo
    • Macro Calculator
    • Research / Studies
    • How-To Videos (US)
  • Get Support
    • Help
    • Contact Us
    • Shipping
    • Warranty & Returns
    • Register Your Meter
  • Shop
    • Products
    • Reviews
    • Service Discount
    • HSA + FSA Eligible
    • My Store Account
  • About
    • Team Keto-Mojo
    • Ketogenic Foundation
    • Press Kit & Brand Assets
    • Work With Us
    • Upcoming Conferences
  • Partners
    • Academia
    • Affiliates
    • Developers
    • Bulk Purchase
    • Remote Patient Monitoring

© 2025 Keto-Mojo.All Rights Reserved.

  • Terms of Service
  • Privacy Policy
  • Disclaimer
  • MyMojoHealth
  • MyMojoMacros
  • MyMojoMarket
  • My Store Account
  • Help
  • → START HERE!
  • Keto Basics
  • Testing Basics
  • Food
  • Health
  • Videos
  • Blog
  • Practitioners
  • Research

More results...

Article
Recipes
Video
LowCarbUSA Speaker
Events
→ START HERE!
  • 7 Steps to Keto Success
  • Keto Guides
  • Health Benefits
  • Fasting
  • Ketosis for Beginners
  • Macros & Calorie Counting
  • Side Effects
  • How-To Videos
  • Ketone/Glucose Testing
  • MyMojoHealth
  • GKI Calculator
  • Infographics
  • Accuracy
  • Testimonials
  • Keto & Low-Carb Recipes
  • Nutrition
  • View/Create Your Meal Plans
  • Macros Calculator
  • My Shopping List
  • Join Our Recipe Newsletter!
  • Weight Loss
  • Fitness
  • Diabetes
  • Epilepsy
  • Neurological
  • Cancer
  • Heart Health
  • Women's Health
  • Men's Health
  • Mojo Academy
  • LowCarbUSA Speaker Series
  • How-To Videos (US)
  • How-To Videos (Europe)
  • MyMojoHealth for Users
  • MyMojoHealth for Practitioners
  • Blog Articles
  • In the News
  • Product and Book Reviews
  • Success Stories
  • Platform Solutions
  • Practitioner Tools
  • Patient Resources
  • The Bigger Picture
  • Testimonials
  • Login
Research

 

Keto Hot Chocolate

Print Recipe
Sure, you can warm your morning and your spirits with Bulletproof Coffee, but here’s a better idea: cozy up with a mug of our heartwarming, lush, and creamy keto hot chocolate! Made with chocolate powder and chips, a touch of spice, almond milk, and heavy cream and topped with whipped cream, it’s like dessert in a mug, only it’s filled with good fats and can easily help push up your fat macros and stave off hunger. Talk about a win-win!
Collections
chocolatecomfort-fooddrinksKosherdessertbreakfastAmericanquick & easykid-friendlycreamvegetariangluten-free
Serves 4 One Serving: 1 cup
IMPERIAL | METRIC

Ingredients List

  • 3 cups unsweetened plain almond milk
  • 1½ cups heavy cream, divided
  • 1/4 cup granulated allulose sweetener (such as RxSugar) or other keto-friendly alternative sweetener
  • 1/4 cup unsweetened cocoa powder (plus a little extra for garnishing, optional)
  • 1/4 cup stevia-sweetened chocolate chips
  • 2 tsp vanilla extract, divided
  • 3/4 tsp ground cinnamon
  • sea salt
  • 2 Tbsp powdered keto-friendly sweetener (we used Swerve Confectioners Sweetener)
Some emerging research suggests that erythritol might increase the risk of blood clots, but more studies are needed to confirm this potential link. Whether you decide to use erythritol or not, remember that all sweeteners should be consumed in moderation, and your keto diet should primarily focus on nutritious whole foods. Learn more: Erythritol Explored: Weighing the Pros and Cons.
IMPERIAL - METRIC

Nutritional Information

Macros per serving

  • 118 Calories
  • 10 g Fat
  • 3 g Protein
  • 6 g Total Carbs
  • 3 g Fiber
  • 3 g Net Carbs

Make sure you’re testing for your individual food sensitivities and bio-individuality.

Bio-Individuality

Instructions

  • In a medium pot, combine the almond milk, 1 cup of the heavy cream, the granulated sweetener, 1/4 cup of the cocoa powder, the chocolate chips, 1-1/2 teaspoons of the vanilla, the cinnamon and 1/2 teaspoon salt. Whisk, then heat over medium-low heat, whisking frequently, until the hot chocolate starts to lightly simmer (do not overheat) and the cocoa powder and chips are completely dissolved, 12 to 14 minutes.
  • Remove from the heat, whisk to combine and scrape off any chocolate stuck to the sides of the pot.
  • Meanwhile, in a medium bowl, add the heavy cream, powdered sweetener, and remaining 1/2 teaspoon vanilla. Using a hand mixer or a balloon whisk, whisk until the whipped cream forms soft peaks.
  • Divide the hot chocolate among 4 mugs, top with a dollop of the whipped cream, sprinkle with the remaining cocoa powder, and serve.

Keto-Mojo is a participant in some affiliate programs and some of the links above will generate a small commission if you make a purchase through a product link on our site. This is at no cost to you.

Credits

RecipeEric Lundy

PhotographyErin Ng

6 reviews

  1. Scarlett says:
    2 months ago

    La probaré

    Reply
  2. Anne Pelland says:
    1 year ago

    Délicieux chocolat chaud! Je n’ai pas ajouté le sucre, j’aime mieux la crème épaisse non sucrée.😊

    Reply
  3. Sandra Beal says:
    5 years ago

    Thank you Team-Mojo your recipe is beyond wonderful. I always look so forward to your emails.
    Thank you..

    Reply
  4. Crissie says:
    5 years ago

    5 stars
    Subbed full fat coconut milk due to nut allergies. But wow – so yummy!

    Reply
  5. Crystal Roberts says:
    5 years ago

    5 stars
    I’m not really sure why someone gave a lower rating when they changed the recipe. The only hot chocolate I have had that compares to this was when I was in Ireland. This is beyond delicious. Thank you!

    Reply
  6. Carol says:
    5 years ago

    3 stars
    I delete the sugar substitutes and add turmeric (1 1/2 tsp ) for healthier drink.

    Reply
4.34 from 3 votes

WRITE A REVIEW to Carol Cancel reply

Your email address will not be published. Required fields are marked *

Your Rating




Tips

Add a few drops of peppermint extract for instant Keto Peppermint Hot Chocolate

Featured Recipes

Keto-Mojo-Tumeric Latte
In Recipes

Keto Turmeric Latte

5 3 reviews
Keto-Mojo-Cinnamon-Frappe
In Recipes

Keto Blended Cinnamon Dolce Frap

4 4 reviews
Keto Chocolate Milkshake Recipe
In Recipes

Keto Chocolate Milkshake

4.91 11 reviews
Kept Green Smoothie
In Recipes

Keto Minty Green Smoothie

In Featured

Pork Rind Pizza

5 5 reviews
In Food

Prosciutto-Wrapped, Ricotta-Stuffed Artichoke Hearts

5 1 review
In Food

Seared Carpaccio

5 1 review
Keto Shrimp Pad Thai
In Recipes

Keto Shrimp Pad Thai

4.75 8 reviews
Summer Squash & Zucchini Gratin Recipe
In Recipes

Keto Summer Squash and Zucchini Gratin

4.67 12 reviews
Keto Cheesy Daikon Potato Gratin Recipe
In Recipes

Keto Cheesy Daikon “Potato Gratin”

4.73 29 reviews
Keto Jumbalaya Recipe
In Recipes

Keto Jambalaya

4.82 16 reviews
Almond Cake Recipe
In Recipes

Keto Almond Cake

4.70 13 reviews
Keto Cauliflower Herb Casserole Recipe
In Featured

Keto Cauliflower Herb Casserole (Savory Kugel)

4.50 2 reviews
Keto Tomato Soup Grilled Cheese Recipe
In Recipes

Keto Creamy Tomato-Basil Soup with “Grilled Cheese” Crackers

5 9 reviews
Keto Chocolate Hazelnut Spread Recipe
In Recipes

Keto Chocolate Hazelnut Spread

5 3 reviews
Keto Beef Burrito Bowl Recipe
In Recipes

Keto Beef Burrito Bowl

5 5 reviews
Keto Steak Kebabs
In Featured

Keto Steak Kebabs

Keto Grilled Zucchini Salad Recipe
In Featured

Keto Grilled Zucchini Salad with Feta and Mint

5 5 reviews
BBQ Chicken with Keto BBQ Sauce Recipe
In Recipes

Barbecued Chicken with Keto Barbecue Sauce

5 3 reviews
Keto Mint Chocolate Ice Cream Recipe
In Recipes

Keto Mint Chip Ice Cream

4.34 9 reviews
Keto Pasta with Pesto, Shrimp, and Mushrooms Recipe
In Recipes

Keto “Pasta” with Pesto, Shrimp, and Mushrooms

5 2 reviews
Banana Bread Recipe
In Recipes

Keto Banana Bread

5 7 reviews
Keto Creamy Chipotle Chicken Recipe
In Recipes

Creamy Keto Chipotle Chicken with Spinach and Lime-Cilantro “Rice”

5 8 reviews
Keto Ground Beef Keema Recipe
In Recipes

Keto Ground Beef Keema

4.96 24 reviews
Thai Time Crunch Salad Recipe
In Recipes

Thai Time Crunch Salad

4.67 12 reviews
Stuffed Birthday Cake Surprise Recipe
In Recipes

Stuffed Birthday Cake Surprise 

4 3 reviews
Keto Asian Pork Meatballs with Miso Aioli Recipe
In Recipes

Keto Asian Pork Meatballs with Miso Aioli

5 3 reviews
Keto Ramon with Shirataki Noodles Recipe
In Recipes

Keto Ramen with Shirataki Noodles

5 5 reviews
Keto Instant Pot Pork Tenderloin Recipe
In Recipes

Keto Instant Pot Pork Tenderloin with Asian Mushrooms

5 3 reviews
Instant Pot BBQ Pork Ribs Recipe
In Recipes

Instant Pot Keto Barbecue Pork Ribs

5 6 reviews
Keto Seeded Crackers Recipe
In Recipes

Keto Seeded Crackers and Goat Cheese

5 3 reviews
Curried Chicken Salad Recipe
In Recipes

Keto Curried Chicken Salad

4.75 4 reviews
Keto Roasted Eggplant and Red Pepper Recipe
In Recipes

Keto Roasted Eggplant, Red Pepper, and Avocado Salad

5 1 review
Roasted Asparagus Soup Recipe
In Recipes

Creamy Roasted Asparagus Soup

5 3 reviews
SHARE
Hide Buttons
cta-booklet

Sign up for our weekly newsletters and receive our keto recipe eBook.

From new research findings and articles to outstanding keto recipes, we deliver the top keto news and recipes straight to you!

Your privacy is our priority.

We follow US and GDPR cookie standards to give you a secure online experience. Please accept cookies to view the newsletter signup form. Learn more in our privacy policy.

ACCEPT COOKIES TO SIGNUP
Keto-Mojo

Questions?

support@keto-mojo.com



Keto-Mojo is not a health care provider. The information provided by Keto-Mojo is informational only and is not intended to provide or be a substitute for medical advice, diagnosis, or treatment.

The Keto-Mojo system is FDA-cleared and CE-marked for use by individuals with diabetes at home (U.S., Canada, EU, South Africa) and by healthcare professionals in clinical settings (EU, South Africa) to monitor the effectiveness of diabetes control. It is not intended for diagnosis or screening. The system may also be used by individuals without diabetes as part of a general wellness routine to monitor glucose and ketone levels related to dietary or lifestyle practices, such as a ketogenic or low-carb diet (U.S.). All content is for informational purposes only and does not constitute medical advice. Always consult your healthcare provider before making changes to your diet, lifestyle, or medications.
Find Us on Linkedin Find Us on Facebook Find Us on Instagram Find Us on YouTube Find Us on Pinterest Find Us on Twitter Email Us
  • Resources
    • MyMojoHealth
    • Request a MMH Demo
    • Macro Calculator
    • Research / Studies
    • How-To Videos (US)
  • Get Support
    • Help
    • Contact Us
    • Shipping
    • Warranty & Returns
    • Register Your Meter
  • Shop
    • Products
    • Reviews
    • Service Discount
    • HSA + FSA Eligible
    • My Store Account
  • About
    • Team Keto-Mojo
    • Ketogenic Foundation
    • Press Kit & Brand Assets
    • Work With Us
    • Upcoming Conferences
  • Partners
    • Academia
    • Affiliates
    • Developers
    • Bulk Purchase
    • Remote Patient Monitoring
Love Your Mojo

© 2025 Keto-Mojo.All Rights Reserved.

  • Terms of Service
  • Privacy Policy
  • Disclaimer
The information we provide at Keto-Mojo.com is not intended to replace consultation with a qualified medical professional. By interacting with this site, you agree to our disclaimer. Read More

With your consent, we and other third-party advertising and analytics partners may use cookies and similar tracking technologies to understand how you use our websites and to deliver, measure and personalize contents and ads. You can change your cookie preferences at any time by selecting “Cookie Settings.” Read More
ACCEPT
REJECT
Privacy & Cookies Policy

Privacy Overview

This website uses cookies to improve your experience while you navigate through the website. Out of these cookies, the cookies that are categorized as necessary are stored on your browser as they are essential for the working of basic functionalities of the website. We also use third-party cookies that help us analyze and understand how you use this website. These cookies will be stored in your browser only with your consent. You also have the option to opt-out of these cookies. But opting out of some of these cookies may have an effect on your browsing experience.
Necessary
Always Enabled

Necessary cookies are absolutely essential for the website to function properly. This category only includes cookies that ensures basic functionalities and security features of the website. These cookies do not store any personal information.

Analytics/Performance

Analytical cookies are used to understand how visitors interact with the website. These cookies help provide information on metrics the number of visitors, bounce rate, traffic source, etc.

Targeting/Marketing

Advertisement cookies are used to provide visitors with relevant ads and marketing campaigns. These cookies track visitors across websites and collect information to provide customized ads.

Functional

Functional cookies help to perform certain functionalities like sharing the content of the website on social media platforms, collect feedbacks, and other third-party features.

Save & Accept
X

Rate This Recipe

Your vote:




A rating is required
A name is required
An email is required

Recipe Ratings without Comment

Something went wrong. Please try again.